Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

C0Q506

Expression Region

1-193

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F5 Antibody - N-terminal region
OAAB05599-400UL 400 µL

E2F5 Antibody - N-terminal region

Sign In for Pricing
View Details
CYB5D1 Human shRNA Plasmid Kit (Locus ID 124637)
TL305143 1 Kit

CYB5D1 Human shRNA Plasmid Kit (Locus ID 124637)

Sign In for Pricing
View Details
Oct-1 (POU2F1) CytoSection
TS408599P5 25 Slides

Oct-1 (POU2F1) CytoSection

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF428 Antibody
NBP2-31922 0.1 mL

Rabbit Polyclonal ZNF428 Antibody

Sign In for Pricing
View Details
ZFP64 (C-3) P
sc-376131 P 100 µg - 0.5 mL

ZFP64 (C-3) P

Sign In for Pricing
View Details
RHOD Antibody
orb1335542 100 µg

RHOD Antibody

Sign In for Pricing
View Details