Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

C0Q506

Expression Region

1-193

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Elastase ELISA Kit
GTR10423772-01 48 Well

Human Elastase ELISA Kit

Sign In for Pricing
View Details
Human Elastase ELISA Kit
GTR10423772-02 96 Well

Human Elastase ELISA Kit

Sign In for Pricing
View Details
Human SFTPA2 (NM_001098668) AAV Particle
RC212495A1V 250 µL

Human SFTPA2 (NM_001098668) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal CD68/SR-D1 Antibody (514H12)
NB100-65101 0.1 mL

Mouse Monoclonal CD68/SR-D1 Antibody (514H12)

Sign In for Pricing
View Details
AVIL, NT (AVIL, Advillin, p92)
032332 200 µL

AVIL, NT (AVIL, Advillin, p92)

Sign In for Pricing
View Details
3- (3,4-Dihydroxyphenyl) -DL-alanine 97%
D30341 5 g

3- (3,4-Dihydroxyphenyl) -DL-alanine 97%

Sign In for Pricing
View Details