Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfA (rnfA)

This Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

C6DH17

Expression Region

1-193

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTVGSMFSWLVN EFILVPLDILYLRTMAFILVLAVVVQFSEMFVRKVSPELYRLLGIFLPLITTNCAVLGVV LLNINLSHGFLKSTIYGFGGAAGFSLVMVLFAAIRERLAVSDIPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodobenzene
TRC-I689500-1G 1 g

Iodobenzene

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF640R conjugate, 0.1mg/mL
BNC402042-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atf6 Mouse Gene Knockout Kit (CRISPR)
KN501721 1 Kit

Atf6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15013-01 50 μL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15013-02 100 µL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15013-03 1 mL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details