Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfA (rnfA)
This Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
C6DH17
Expression Region
1-193
Origin
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTVGSMFSWLVN EFILVPLDILYLRTMAFILVLAVVVQFSEMFVRKVSPELYRLLGIFLPLITTNCAVLGVV LLNINLSHGFLKSTIYGFGGAAGFSLVMVLFAAIRERLAVSDIPAPFRGSSIALITAGLM SLAFMGFTGLVKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15127785 1 Vial
Lentiviral human POMC shRNA (UAS) - Lentiviral human POMC shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
E8361 96 Tests
MAM and LDL-Receptor class A domain-containing protein C10orf112 (C10orf112) Human ELISA Kit
Sign In for Pricing
View Details 175442 1 Bag (200 Label (s) x 1 Roll)
LAM-262-910 Laminator Supplies
Sign In for Pricing
View Details