Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B1IQC7

Expression Region

1-193

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf222 (NM_001003808) Human Recombinant Protein
TP321806M 100 µg

C1orf222 (NM_001003808) Human Recombinant Protein

Sign In for Pricing
View Details
1,2-thiazetidine-1,1-dione
TRC-B703548-10MG 10 mg

1,2-thiazetidine-1,1-dione

Sign In for Pricing
View Details
Human MMAB activation kit by CRISPRa
GA117332 1 Kit

Human MMAB activation kit by CRISPRa

Sign In for Pricing
View Details
Noct Mouse Gene Knockout Kit (CRISPR)
KN502844 1 Kit

Noct Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PF4 (NM_002619) Human Over-expression Lysate
LC400930 20 µg

PF4 (NM_002619) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PARP11 activation kit by CRISPRa
GA111368 1 Kit

Human PARP11 activation kit by CRISPRa

Sign In for Pricing
View Details