Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B1LEQ9

Expression Region

1-193

Origin

Escherichia coli (strain SMS-3-5 / SECEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK3 (Kallikrein-3), human recombinant
4727-20 20 µg

KLK3 (Kallikrein-3), human recombinant

Sign In for Pricing
View Details
Mouse Zfp280c Pre-designed siRNA Set B
SI116383B 1 Each

Mouse Zfp280c Pre-designed siRNA Set B

Sign In for Pricing
View Details
TAF5LP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2328407 1.0 µg DNA

TAF5LP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mmu-miR-193b-3p miRNA Inhibitor
orb1870422-01 10 nmol

Mmu-miR-193b-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-193b-3p miRNA Inhibitor
orb1870422-02 20 nmol

Mmu-miR-193b-3p miRNA Inhibitor

Sign In for Pricing
View Details
Canine Concanavalin A ELISA Kit
MBS046462-01 48 Well

Canine Concanavalin A ELISA Kit

Sign In for Pricing
View Details