Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Electron transport complex protein RnfA (rnfA)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B1JKN2

Expression Region

1-193

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPD52L1 (Tumor Protein D52-like 1, Tumor Protein D53, D53, hD53) (FITC)
MBS6261948-01 0.1 mL

TPD52L1 (Tumor Protein D52-like 1, Tumor Protein D53, D53, hD53) (FITC)

Sign In for Pricing
View Details
TPD52L1 (Tumor Protein D52-like 1, Tumor Protein D53, D53, hD53) (FITC)
MBS6261948-02 5x 0.1 mL

TPD52L1 (Tumor Protein D52-like 1, Tumor Protein D53, D53, hD53) (FITC)

Sign In for Pricing
View Details
Anti-CMBL Antibody, Rabbit Polyclonal
MBS8105304-01 0.1 mL

Anti-CMBL Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CMBL Antibody, Rabbit Polyclonal
MBS8105304-02 5x 0.1 mL

Anti-CMBL Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
TPT1P1 Adenovirus (Human)
47411051 1.0 mL

TPT1P1 Adenovirus (Human)

Sign In for Pricing
View Details
SLC2A9 Antibody
A68442-100UG 100 µg

SLC2A9 Antibody

Sign In for Pricing
View Details