Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Electron transport complex protein RnfA (rnfA)

This Recombinant Shigella flexneri serotype 5b Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q0T4F0

Expression Region

1-193

Origin

Shigella flexneri serotype 5b (strain 8401)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLTSICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LRRCC1 Protein
E30P64546B 50 µg

Recombinant Human LRRCC1 Protein

Sign In for Pricing
View Details
Mouse SPOCK3 Protein, His Tag
E40MOP1348 20 µg

Mouse SPOCK3 Protein, His Tag

Sign In for Pricing
View Details
Lamb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
26278114 3x 1.0 µg

Lamb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Anti Human Cd2 Monoclonal Antibody,RPE-Cy5
CABT-47984MH 2ml

Mouse Anti Human Cd2 Monoclonal Antibody,RPE-Cy5

Sign In for Pricing
View Details
Recombinant Danio rerio Optineurin (optn), partial
MBS1322165 Inquire

Recombinant Danio rerio Optineurin (optn), partial

Sign In for Pricing
View Details
15-LO2 (F-10) PE
sc-376795 PE 200 µg/mL

15-LO2 (F-10) PE

Sign In for Pricing
View Details