Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis bv. Antiqua Electron transport complex protein RnfA (rnfA)

This Recombinant Yersinia pestis bv. Antiqua Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q1C7K1

Expression Region

1-193

Origin

Yersinia pestis bv. Antiqua (strain Antiqua)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), 1mg/mL
BNUM0181-50 1x 50 µL

CD59 (heavy chain of Protectin) (BRA-10G), 1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
BNC400718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL
BNC041950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL
BNC881857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details