Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q1RBG9

Expression Region

1-193

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPC2 siRNA
abx915492-01 15 nmol

Human EPC2 siRNA

Sign In for Pricing
View Details
Human EPC2 siRNA
abx915492-02 30 nmol

Human EPC2 siRNA

Sign In for Pricing
View Details
ANGPTL3/Angiopoietin-like 3 Protein, Mouse, Recombinant (His Tag)
E45M52819I2-200 200 µg

ANGPTL3/Angiopoietin-like 3 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
C1QC (NM_172369) Human Tagged Lenti ORF Clone
RC203832L3 10 µg

C1QC (NM_172369) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ThrS Antibody
orb832922 2 mg

ThrS Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Histidine--tRNA ligase (hisS)
MBS1453557-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details