Recombinant Hahella chejuensis Electron transport complex protein RnfA (rnfA)
This Recombinant Hahella chejuensis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
Q2SKU4
Expression Region
1-193
Origin
Hahella chejuensis (strain KCTC 2396)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTEYLLILVSTILVNNFVLVQFLGLCPFMGVSNKLETAMGMSLATTFVLTLSSLCSYLAY EYLLAPLGMEFLKTITFILVIAVVVQFTEMVIKKTSPLLYRVLGIFLPLITTNCAVLGVA LLNIKKQNDFMESILYGFGAAVGFSLVLTLFSAMRERIAAADVPEPFKGGAIGMITAGLM SLAFLGFTGLVNI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15358536 1 Vial
Lentiviral human NT5M sgRNA gene knockout kit - Lentiviral human NT5M sgRNA gene knockout kit (25)
Sign In for Pricing
View Details MBS8421054-01 0.1 mL
Single Donor Human SARS-Cov-2 Presumptive Non-Placebo Vaccine Positive Plasma
Sign In for Pricing
View Details MBS8421054-02 5x 0.1 mL
Single Donor Human SARS-Cov-2 Presumptive Non-Placebo Vaccine Positive Plasma
Sign In for Pricing
View Details LV808086 1.0 µg DNA
DZANK1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
