Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Electron transport complex protein RnfA (rnfA)

This Recombinant Shigella dysenteriae serotype 1 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q32FE6

Expression Region

1-193

Origin

Shigella dysenteriae serotype 1 (strain Sd197)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIST (GOPC) Rabbit Polyclonal Antibody
TA376681 100 µL

PIST (GOPC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX2 (NM_000278) Human Over-expression Lysate
LC400106 20 µg

PAX2 (NM_000278) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR562472 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
4-Hydroxythiobenzamide
TRC-H807820-10G 10 g

4-Hydroxythiobenzamide

Sign In for Pricing
View Details
Sertm1 Mouse Gene Knockout Kit (CRISPR)
KN515616 1 Kit

Sertm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF594 conjugate, 0.1mg/mL
BNC942034-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details