Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Electron transport complex protein RnfA (rnfA)

This Recombinant Shigella dysenteriae serotype 1 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q32FE6

Expression Region

1-193

Origin

Shigella dysenteriae serotype 1 (strain Sd197)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPN (NM_001100625) Human Over-expression Lysate
LY420287 100 µg

CENPN (NM_001100625) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Col12a1 activation kit by CRISPRa
GA200805 1 Kit

Mouse Col12a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Allylboronic acid pinacol ester
TRC-A614258-250MG 250 mg

Allylboronic acid pinacol ester

Sign In for Pricing
View Details
Recombinant Mouse Activin Receptor 2B/ACVR2B Protein (His Tag)
PKSM040825 100 µg

Recombinant Mouse Activin Receptor 2B/ACVR2B Protein (His Tag)

Sign In for Pricing
View Details
TNNT1 Polyclonal Antibody
E-AB-53126-01 20 µL

TNNT1 Polyclonal Antibody

Sign In for Pricing
View Details
TNNT1 Polyclonal Antibody
E-AB-53126-02 60 µL

TNNT1 Polyclonal Antibody

Sign In for Pricing
View Details