Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas haloplanktis Electron transport complex protein RnfA (rnfA)

This Recombinant Pseudoalteromonas haloplanktis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q3IKD8

Expression Region

1-193

Origin

Pseudoalteromonas haloplanktis (strain TAC 125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYVLLLIGTVLVNNFVLVQFLGLCPFMGVSSKLDTAIGMSLATTFVLTLASVTSYLVN QYILIPLDITYLRTMSFILVIAVVVQFTEMVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNIKEDHSFLQSAVYGFGAAVGFSLVLVLFAALRERLAAADVPTPFKGASIALITAGLM SMAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAUS4 (NM_001166269) Human Over-expression Lysate
LC432946 20 µg

HAUS4 (NM_001166269) Human Over-expression Lysate

Sign In for Pricing
View Details
Mercurous Chloride (Mercury (I) Chloride)
1131260 500 500 g

Mercurous Chloride (Mercury (I) Chloride)

Sign In for Pricing
View Details
BAM-12P (7-12)
H-5365.0025 25.0mg

BAM-12P (7-12)

Sign In for Pricing
View Details
TTC19 CRISPR Activation Plasmid (h)
sc-412375-ACT 20 µg

TTC19 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human FAM20B shRNA (UAS) - Lentiviral human FAM20B shRNA (UAS, GFP) (25)
GTR15318515 1 Vial

Lentiviral human FAM20B shRNA (UAS) - Lentiviral human FAM20B shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PELO antibody
70R-19211 50 μL

PELO antibody

Sign In for Pricing
View Details