Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. UPF0059 membrane protein cbdbA1062 (cbdbA1062)

This Recombinant Dehalococcoides sp. UPF0059 membrane protein cbdbA1062 (cbdbA1062) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

UPF0059 membrane protein cbdbA1062

UniProt

Q3ZY72

Expression Region

1-193

Origin

Dehalococcoides sp. (strain CBDB1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLSVIFIALGLSADCFAVSIGIACTHASIKSRVIWRVAGTFGLFQAGMVVIGFFAGLS VIDIISAFDHWIAFGLLLFIGVRMIYEALQGEDDQELVKLDLTRGLGLLGVAVATSIDAL AVGLAFAVEETNIGLAALLIGLVSLTVSFLGFKLGNRISFMASRWVGVAGGLVLVFIGLK ILAEHTLGWDILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nociceptin receptor (OPRL1) (NM_000913) Human Over-expression Lysate
LY424459 100 µg

Nociceptin receptor (OPRL1) (NM_000913) Human Over-expression Lysate

Sign In for Pricing
View Details
SERTM1 (NM_203451) Human Over-expression Lysate
LC404296 20 µg

SERTM1 (NM_203451) Human Over-expression Lysate

Sign In for Pricing
View Details
Cortisone Sodium Succinate
TRC-C696505-10MG 10 mg

Cortisone Sodium Succinate

Sign In for Pricing
View Details
TNNT3 (NM_001297646) Human Tagged ORF Clone
RG236926 10 µg

TNNT3 (NM_001297646) Human Tagged ORF Clone

Sign In for Pricing
View Details
2,2-Diphenylglycine
TRC-D491620-25G 25 g

2,2-Diphenylglycine

Sign In for Pricing
View Details
Dibenzyl Disulphide
TRC-D417080-1G 1 g

Dibenzyl Disulphide

Sign In for Pricing
View Details