Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colwellia psychrerythraea Electron transport complex protein RnfA (rnfA)

This Recombinant Colwellia psychrerythraea Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q482U3

Expression Region

1-193

Origin

Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLLVGTVLVNNFVLVQFLGLCPFMGVSSRTETAIGMSFATVFVMTLASLLSYLVT TYLLVPLNLEYLTTMSFILVIAVVVQFTEMVVHKTSASLYRLLGIFLPLITTNCAVLGVA LLNLRLQHGFFESIIYGFGAALGFSLVLIMFSAMREKLANADVPAPFKGTAIAMITAGLM SLAFLGFTGLVKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fhl4 activation kit by CRISPRa
GA201420 1 Kit

Mouse Fhl4 activation kit by CRISPRa

Sign In for Pricing
View Details
Mitochondrial Marker (MTC719), CF740 conjugate, 0.1mg/mL
BNC740719-100 1x 100 µL

Mitochondrial Marker (MTC719), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slc7a14 Mouse Gene Knockout Kit (CRISPR)
KN516191 1 Kit

Slc7a14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS631562 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant Rat CD86/B7-2 Protein (His Tag)
PKSR030396 100 µg

Recombinant Rat CD86/B7-2 Protein (His Tag)

Sign In for Pricing
View Details
FNDC8 (NM_017559) Human Recombinant Protein
TP305252 20 µg

FNDC8 (NM_017559) Human Recombinant Protein

Sign In for Pricing
View Details