Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella choleraesuis Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella choleraesuis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q57PH8

Expression Region

1-193

Origin

Salmonella choleraesuis (strain SC-B67)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HBZ (NM_005332) Human Recombinant Protein
TP306504L 1 mg

HBZ (NM_005332) Human Recombinant Protein

Sign In for Pricing
View Details
Rpf1 Mouse Gene Knockout Kit (CRISPR)
KN515003 1 Kit

Rpf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,5-Hexanedione-d10
TRC-H292492-500MG 500 mg

2,5-Hexanedione-d10

Sign In for Pricing
View Details
Solabegron Hydrochloride
TRC-S676510-1MG 1 mg

Solabegron Hydrochloride

Sign In for Pricing
View Details
(KO Validated) IGF1R Polyclonal Antibody
E-AB-68249-01 60 µL

(KO Validated) IGF1R Polyclonal Antibody

Sign In for Pricing
View Details