Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfA (rnfA)
This Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA, Nitrogen fixation protein RnfA
UniProt
Q6D4W4
Expression Region
1-193
Origin
Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTEYALLFVSILLVNNFVLVKFLGLCPFMGVSKKLETAIGMGMATTFVMTLGSMFSWLIN EFILVPLDILYLRTMAFILVLAVVVQFSEMFVRKVSPELYRLLGIFLPLITTNCAVLGVV LLNINLSHGFLQSTIYGFGGAAGFSLVMVLFAAIRERLAVSDIPAPFRGSSIALITAGLM SLAFMGFTGLVKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740460-100 1x 100 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041725-500 1x 500 µL
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742059-100 1x 100 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details