Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q83KY7

Expression Region

1-193

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLTSICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL
BNC682592-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3Beta,17Beta-Androst-5-enediol
TRC-A637670-2.5G 2.5 g

3Beta,17Beta-Androst-5-enediol

Sign In for Pricing
View Details
Aegopodium podagragria Gel -APP- Immobilized Lectin
AK-8003-1 1 mL/Kit

Aegopodium podagragria Gel -APP- Immobilized Lectin

Sign In for Pricing
View Details
R-PE Antibody Labeling Kit
ALK-A001-100ug 100 µg

R-PE Antibody Labeling Kit

Sign In for Pricing
View Details
N-(2-Aminoethyl-1,1,2,2-d4)-5-chloroisoquinoline-8-sulfonamide Dihydrochloride
TRC-A608859-50MG 50 mg

N-(2-Aminoethyl-1,1,2,2-d4)-5-chloroisoquinoline-8-sulfonamide Dihydrochloride

Sign In for Pricing
View Details
Human PPIL1 activation kit by CRISPRa
GA109918 1 Kit

Human PPIL1 activation kit by CRISPRa

Sign In for Pricing
View Details