Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q83KY7

Expression Region

1-193

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLTSICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (SOX10/2311R), CF568 conjugate, 0.1mg/mL
BNC682311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLF6 (NM_001160125) Human Over-expression Lysate
LY431195 100 µg

KLF6 (NM_001160125) Human Over-expression Lysate

Sign In for Pricing
View Details
SRGAP2C (NM_001271872) Human Tagged ORF Clone
RG238347 10 µg

SRGAP2C (NM_001271872) Human Tagged ORF Clone

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL
BNC882453-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS713432 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant Human ACSL4 Protein (Trx Tag)
PDEH100615-01 20 µg

Recombinant Human ACSL4 Protein (Trx Tag)

Sign In for Pricing
View Details