Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q8KA21

Expression Region

1-193

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSYFFFILSNILIDNFILVKFLGLCPFIGASNQIKQAFGISFATSFVVVVSTVLLWFVN FFILLPFDLVYLRIIVYMLIISFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIP LFSLYLNHTFLESILYAVSASFGFTLVMVIFSSIRERILLSDVPLAFQGSPIVLITVSLI SIVFMGFKGLVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP2 Antibody (C-term)
E45R32577G-4 50 µL

IGFBP2 Antibody (C-term)

Sign In for Pricing
View Details
Human OR6M1 qPCR Primer Pair
QH76133S 200 Tests

Human OR6M1 qPCR Primer Pair

Sign In for Pricing
View Details
LY 171859
MBS5777583 Inquire

LY 171859

Sign In for Pricing
View Details
TRNAS9 3'UTR Luciferase Stable Cell Line
TU027125 1.0 mL

TRNAS9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PHF17 Antibody
C48710-01 40 µL

PHF17 Antibody

Sign In for Pricing
View Details
PHF17 Antibody
C48710-02 100 µL

PHF17 Antibody

Sign In for Pricing
View Details