Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q8KA21

Expression Region

1-193

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSYFFFILSNILIDNFILVKFLGLCPFIGASNQIKQAFGISFATSFVVVVSTVLLWFVN FFILLPFDLVYLRIIVYMLIISFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIP LFSLYLNHTFLESILYAVSASFGFTLVMVIFSSIRERILLSDVPLAFQGSPIVLITVSLI SIVFMGFKGLVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2A alpha (Phospho-Tyr307) Rabbit mAb
14129 50 µL

PP2A alpha (Phospho-Tyr307) Rabbit mAb

Sign In for Pricing
View Details
Rabbit Anti MUC5AC Polyclonal Affinity Purified (PBS with 0.02% sodium azide and 50% glycerol pH 7.4.) (IHC)
IRBAMLMUC5ACAP037120UL 1 Each

Rabbit Anti MUC5AC Polyclonal Affinity Purified (PBS with 0.02% sodium azide and 50% glycerol pH 7.4.) (IHC)

Sign In for Pricing
View Details
Human ACTN3 Knockout A549 cell line
GTR15401732 1 Vial

Human ACTN3 Knockout A549 cell line

Sign In for Pricing
View Details
APC anti-mouse CD169 (Siglec-1)
GT04554 25 µg

APC anti-mouse CD169 (Siglec-1)

Sign In for Pricing
View Details
DNASE1 Rabbit pAb
E2122246 100 µL

DNASE1 Rabbit pAb

Sign In for Pricing
View Details
C-SRC, phosphorylated (Tyr215) (ASV, SRC1, p60-Src) (HRP) discontinued
S6503-06-HRP 100 µL

C-SRC, phosphorylated (Tyr215) (ASV, SRC1, p60-Src) (HRP) discontinued

Sign In for Pricing
View Details