Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA)
This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
Q8KA21
Expression Region
1-193
Origin
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKSYFFFILSNILIDNFILVKFLGLCPFIGASNQIKQAFGISFATSFVVVVSTVLLWFVN FFILLPFDLVYLRIIVYMLIISFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIP LFSLYLNHTFLESILYAVSASFGFTLVMVIFSSIRERILLSDVPLAFQGSPIVLITVSLI SIVFMGFKGLVRI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6287071-01 0.1 mL
CMTM5, ID (CMTM5, CKLFSF5, CKLF-like MARVEL transmembrane domain-containing protein 5, Chemokine-like factor superfamily member 5) (MaxLight 550)
Sign In for Pricing
View Details MBS6287071-02 5x 0.1 mL
CMTM5, ID (CMTM5, CKLFSF5, CKLF-like MARVEL transmembrane domain-containing protein 5, Chemokine-like factor superfamily member 5) (MaxLight 550)
Sign In for Pricing
View Details ![Recombinant Cyanothece sp. GMP synthase [glutamine-hydrolyzing] (guaA), partial](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
MBS1004060 Inquire
Recombinant Cyanothece sp. GMP synthase [glutamine-hydrolyzing] (guaA), partial
Sign In for Pricing
View Details MBS6315383-01 0.2 mL
LC3B, Phosphorylated (T12) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtu
Sign In for Pricing
View Details MBS6315383-02 5x 0.2 mL
LC3B, Phosphorylated (T12) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtu
Sign In for Pricing
View Details