Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q8ZEC8

Expression Region

1-193

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MET (HGF Receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (MaxLight 405) discontinued
M3007-20G-ML405 100 µL

MET (HGF Receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PNN/DRSP Rabbit Polyclonal Antibody (Carrier-free)
orb3113475 100 µg

PNN/DRSP Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
PLV3-CMV-TXNRD3-CopGFP-Puro Plasmid
PVT65930 2 µg

PLV3-CMV-TXNRD3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
CAPN14 Antibody
orb52430-01 50 µg

CAPN14 Antibody

Sign In for Pricing
View Details
CAPN14 Antibody
orb52430-02 100 µg

CAPN14 Antibody

Sign In for Pricing
View Details
PPP2R4 Mouse mAb Antibody
orb3063731-01 50 µL

PPP2R4 Mouse mAb Antibody

Sign In for Pricing
View Details