Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfA (rnfA)

This Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A6V1T9

Expression Region

1-194

Origin

Pseudomonas aeruginosa (strain PA7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAICSYILQ RYVLRPLDLEFLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVA LLNANRAEYGFLEATTQGFGAGLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGL MSLAFMGFSGLIRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMX2 (Homeobox Protein EMX2, Empty Spiracles Homolog 2, Empty Spiracles-like Protein 2) (PE)
126312-PE 100 µL

EMX2 (Homeobox Protein EMX2, Empty Spiracles Homolog 2, Empty Spiracles-like Protein 2) (PE)

Sign In for Pricing
View Details
Pigeon Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit
MBS9910168 Inquire

Pigeon Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit

Sign In for Pricing
View Details
DMEM / F12 Mycoplasma Removal Medium with HEPES
abx704922 100 mL

DMEM / F12 Mycoplasma Removal Medium with HEPES

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) DLT Polyclonal Antibody
MBS7147760 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) DLT Polyclonal Antibody

Sign In for Pricing
View Details
PRKRA Antibody
orb1559569-01 50 µL

PRKRA Antibody

Sign In for Pricing
View Details
PRKRA Antibody
orb1559569-02 100 µL

PRKRA Antibody

Sign In for Pricing
View Details