Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfA (rnfA)

This Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A6V1T9

Expression Region

1-194

Origin

Pseudomonas aeruginosa (strain PA7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAICSYILQ RYVLRPLDLEFLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVA LLNANRAEYGFLEATTQGFGAGLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGL MSLAFMGFSGLIRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNAM-1 Protein, mFc-His Tag
orb689406-01 10 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details
Human DNAM-1 Protein, mFc-His Tag
orb689406-02 50 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details
Human DNAM-1 Protein, mFc-His Tag
orb689406-03 100 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details
Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit
MBS2890110-01 48 Well

Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit
MBS2890110-02 96 Well

Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit
MBS2890110-03 5x 96 Well

Mouse PYCR1/Pyrroline-5-Carboxylate Reductase 1, Mitochondrial ELISA Kit

Sign In for Pricing
View Details