Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Electron transport complex protein RnfA (rnfA)
This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-194.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
Q89AX0
Expression Region
1-194
Origin
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVMHFFLLFVSNILINNFILVRFLGLCPFMGISRTIDSAIGMGLATTCVIVFVSIISWLI NFYILIPFHLIHLCTMTYMLIIAVSVQIFEIIVKKVSSTLYRLLGIYLPLITTNCSVLAI PLMNTKLNSNFIESVLYGFSSSLGFFLVLVIFSSIRERISESDVPMYFRGYPIALITASL LAIAFMGFDGLIKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470043-500 1x 500 µL
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470012-100 1x 100 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details