Recombinant Helicobacter pylori Acid-activated urea channel (ureI)
This Recombinant Helicobacter pylori Acid-activated urea channel (ureI) spans the amino acid sequence from region 1-195.
Product Specifications
Product Name Alternative
Acid-activated urea channel, Urease accessory protein UreI
UniProt
P56874
Expression Region
1-195
Origin
Helicobacter pylori (strain J99) (Campylobacter pylori J99)
Field of Research
Infectious Disease & Virology; Kidney & Urological Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLGLVLLYVGIVLISNGICGLTKVDPKSTAVMNFFVGGLSIVCNVVVITYSALHPTAPVE GAEDIVQVSHHLTSFYGPATGLLFGFTYLYAAINHTFGLDWRPYSWYSLFVAINTVPAAI LSHYSDMLDDHKVLGITEGDWWAIIWLAWGVLWLTAFIENILKIPLGKFTPWLAIIEGIL TAWIPAWLLFIQHWV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740270-500 1x 500 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401577-500 1x 500 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details