Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cysteine/O-acetylserine efflux protein (eamB)

This Recombinant Cysteine/O-acetylserine efflux protein (eamB) spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

Cysteine/O-acetylserine efflux protein

UniProt

Q8XA19

Expression Region

1-195

Origin

Escherichia coli O157:H7

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPTLLSAFWTYTLITAMTPGPNNILALSSATTHGFHQSTRVLAGMSLGFLIVMLLCAGI SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKI ILYGVTALSTFVLPQTQALSWIVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI VLALLLIYCAVRIFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL
BNC040224-100 1x 100 µL

Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF647 conjugate, 0.1mg/mL
BNC470765-100 1x 100 µL

Chromogranin A (CHGA/765), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details