Recombinant Lactococcus lactis subsp. cremoris Pantothenic acid transporter PanT (panT)
This Recombinant Lactococcus lactis subsp. cremoris Pantothenic acid transporter PanT (panT) spans the amino acid sequence from region 1-196.
Product Specifications
Product Name Alternative
Pantothenic acid transporter PanT, Pantothenic acid ECF transporter S component PanT
UniProt
A2RIQ0
Expression Region
1-196
Origin
Lactococcus lactis subsp. cremoris (strain MG1363)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKKSKASDVAILAIFIAIMVVVQLFTQFVINVWPFPVKPTLLHLPVIIGSIILGWRKGAF LGLVWGLISFVTATIVTTPTSFLFSPFQPVIGTHHGSPWGLFIAFIPRILVGILPYFVYK IANNRLGAGLAAFAGTATNTVLVLTSIFLFFGSTLKWSLSYLLGAIVATNSLTEVIIAVI LTTAIVPALTKARNNS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941170-100 1x 100 µL
Vimentin (VM1170), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681867-500 1x 500 µL
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details