Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY (bioY)

This Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY (bioY) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Probable biotin transporter BioY

UniProt

P22819

Expression Region

1-196

Origin

Lysinibacillus sphaericus (Bacillus sphaericus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKQQSTLSLVMIAMFAALTAVGAFIKIPLPLVPFTLQIVFVFLAGCLLGGRNGFQSQLV YIGIGLVGLPVFTQGGGITYVLQPTFGYLIGFALAALVIGYMIDRVESPTKKHFIVANII GLIIIYAVAVPYLYVALNVWLNMKSSWSHVFLVGFVNSIVADFCLAIASALLAERLYKVF RSARAIKLVQIEKENV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL
BNC402747-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
BNC682302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details