Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter hamburgensis Probable intracellular septation protein A (Nham_0403)

This Recombinant Nitrobacter hamburgensis Probable intracellular septation protein A (Nham_0403) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

Q1QR53

Expression Region

1-199

Origin

Nitrobacter hamburgensis (strain X14 / DSM 10229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKKQPHPLFKLATELGPLLVFFAANAKFNLFVATAAFMVAIVAAMIASYVVTRHIPLMA LVTGIVVIVFGTLTLVLHDETFIKVKPTIIYSLFAGVLGGGLLFGRSFIAIMFDQVFNLT PRGWQVLTLRWALFFFGMAILNELIWRTQSTDFWVNFKVFGAVPLTMIFAMMQMPLTKRY HLEPATLEASDASEGDVRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL
BNC040870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details