Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative rhomboid protease ydcA (ydcA)

This Recombinant Bacillus subtilis Putative rhomboid protease ydcA (ydcA) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Putative rhomboid protease ydcA, EC= 3.4.21.-

UniProt

P96617

Expression Region

1-199

Origin

Bacillus subtilis (strain 168)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIRTENFQTFIRLYPVVTFILALQAVLWLFFSLPAHSVVLWRDTVTGYNLGVANGEWWR LITPILLHAGFTHLLFNSMSIFLFAPALERMLGKARFLLVYAGSGIIGNIGTYVTEPLDY VHVGASGAIFGLFGVYLFMVLFRNELIGQEHSKMIITLLAFAVLMSFINSNINMMAHLFG LCGGFLLSFLCVQKKERRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluorobenzoic Acid
TRC-F588380-1G 1 g

2-Fluorobenzoic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometriotic tissue
CB502542 1 Block

Frozen Tissue Blocks, Endometriotic tissue

Sign In for Pricing
View Details
ZNF792 Human qPCR Primer Pair (NM_175872)
HP218650 200 Reactions

ZNF792 Human qPCR Primer Pair (NM_175872)

Sign In for Pricing
View Details
Thermo Shaker Incubator BSTH-204
BSTH-204 1 Unit

Thermo Shaker Incubator BSTH-204

Sign In for Pricing
View Details
(-)-Beta-Sesquiphellandrene
TRC-S280655-2.5MG 2.5 mg

(-)-Beta-Sesquiphellandrene

Sign In for Pricing
View Details
SUOX (NM_000456) Human Recombinant Protein
TP309066M 100 µg

SUOX (NM_000456) Human Recombinant Protein

Sign In for Pricing
View Details