Recombinant Brucella melitensis biotype 1 Probable intracellular septation protein A (BMEI0130)
This Recombinant Brucella melitensis biotype 1 Probable intracellular septation protein A (BMEI0130) spans the amino acid sequence from region 1-200.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
Q8YJF3
Expression Region
1-200
Origin
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAPIFLATALFMAATVIALAISW SMTRTLAIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIVNTLFGGILLGGLFFGKSLLG YVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFSTDTWVSFKVWGIMPITIVFT LLQMPLIQKHSLTDEENTAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680043-100 1x 100 µL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940029-100 1x 100 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details