Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum UPF0059 membrane protein CLI_1375 (CLI_1375)

This Recombinant Clostridium botulinum UPF0059 membrane protein CLI_1375 (CLI_1375) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

UPF0059 membrane protein CLI_1375

UniProt

A7GCY0

Expression Region

1-201

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLISVILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIACDYAVGEKKCLNNKTLILLA IATSIDALAVGVSFAFLKVSIINTIVIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGV VLILIGVKIFIQHTNILSYIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0961R-BF594-TR 20 µL

Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
(±) 14 (15) -EET-SI
orb1985158-01 25 µg

(±) 14 (15) -EET-SI

Sign In for Pricing
View Details
(±) 14 (15) -EET-SI
orb1985158-02 50 µg

(±) 14 (15) -EET-SI

Sign In for Pricing
View Details
(±) 14 (15) -EET-SI
orb1985158-03 100 µg

(±) 14 (15) -EET-SI

Sign In for Pricing
View Details
RPL7AP50 CRISPRa sgRNA lentivector (set of three targets)(Human)
41828121 3x 1.0µg DNA

RPL7AP50 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
(Rac) -Hydroxycotinine-d3
HY-113239S2 1 mg

(Rac) -Hydroxycotinine-d3

Sign In for Pricing
View Details