Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum UPF0059 membrane protein CLI_1375 (CLI_1375)

This Recombinant Clostridium botulinum UPF0059 membrane protein CLI_1375 (CLI_1375) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

UPF0059 membrane protein CLI_1375

UniProt

A7GCY0

Expression Region

1-201

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLISVILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIACDYAVGEKKCLNNKTLILLA IATSIDALAVGVSFAFLKVSIINTIVIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGV VLILIGVKIFIQHTNILSYIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP3 modulators 1
MBS5800051 Inquire

NLRP3 modulators 1

Sign In for Pricing
View Details
Tnfrsf26 Mouse Gene Knockout Kit (CRISPR)
KN517989 1 Kit

Tnfrsf26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Human CD14 Antibody (F1031), PE
MBS1582930-01 50 Tests

Anti-Human CD14 Antibody (F1031), PE

Sign In for Pricing
View Details
Anti-Human CD14 Antibody (F1031), PE
MBS1582930-02 100 Tests

Anti-Human CD14 Antibody (F1031), PE

Sign In for Pricing
View Details
Anti-Human CD14 Antibody (F1031), PE
MBS1582930-03 5x 100 Tests

Anti-Human CD14 Antibody (F1031), PE

Sign In for Pricing
View Details
FMoc-N-Methyl-D-2-aMinobutyric acid
276790-01 250 mg

FMoc-N-Methyl-D-2-aMinobutyric acid

Sign In for Pricing
View Details