Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei Thiamine transporter ThiT (thiT)

This Recombinant Lactobacillus casei Thiamine transporter ThiT (thiT) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Thiamine transporter ThiT, Thiamine ECF transporter S component ThiT

UniProt

Q037U3

Expression Region

1-201

Origin

Lactobacillus casei (strain ATCC 334)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQHKQLVVILETAIIAAFAMALTYIPHTTGVSAIELNYGLIPIAVLAMRRGLVPAAWAG FVWGILDLILRGIGGGSVLNPLQGILEYPIAFTLVGLMGLTFASFQKAVRGSEKVKASGY AFAGIIIGTFAKYFIHFIAGVVFWGAYAPKGTNVWVYSLIVNGGSALFSTVLTIVVVGVL LTVAPQLFVAKDGKSFSTKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (B-Cell Marker) (CLIP/3127R), CF405S conjugate, 0.1mg/mL
BNC043127-100 1x 100 µL

CD74 (B-Cell Marker) (CLIP/3127R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c-Jun (JUN) non phospho Ser73 Rabbit Polyclonal Antibody
AP02547PU-N 100 µL

c-Jun (JUN) non phospho Ser73 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tau (MAPT) Human Gene Knockout Kit (CRISPR)
KN213312LP 1 Kit

Tau (MAPT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF594 conjugate, 0.1mg/mL
BNC940021-100 1x 100 µL

Cytokeratin 18 (DC10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PSME1 activation kit by CRISPRa
GA103887 1 Kit

Human PSME1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 13 Recombinant Rabbit Monoclonal Antibody [SN71-09]
ET1611-55 100 µL

Cytokeratin 13 Recombinant Rabbit Monoclonal Antibody [SN71-09]

Sign In for Pricing
View Details