Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei Thiamine transporter ThiT (thiT)

This Recombinant Lactobacillus casei Thiamine transporter ThiT (thiT) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Thiamine transporter ThiT, Thiamine ECF transporter S component ThiT

UniProt

Q037U3

Expression Region

1-201

Origin

Lactobacillus casei (strain ATCC 334)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQHKQLVVILETAIIAAFAMALTYIPHTTGVSAIELNYGLIPIAVLAMRRGLVPAAWAG FVWGILDLILRGIGGGSVLNPLQGILEYPIAFTLVGLMGLTFASFQKAVRGSEKVKASGY AFAGIIIGTFAKYFIHFIAGVVFWGAYAPKGTNVWVYSLIVNGGSALFSTVLTIVVVGVL LTVAPQLFVAKDGKSFSTKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf49 Antibody
8C16888-AAT 50 µg

C14orf49 Antibody

Sign In for Pricing
View Details
Tropomodulin 1 (TMOD1) Rabbit Polyclonal Antibody
TA370869 100 µL

Tropomodulin 1 (TMOD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561108 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706975 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), Biotin conjugate, 0.1mg/mL
BNCB3640-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CKMT2 (NM_001825) Human Over-expression Lysate
LC400691 20 µg

CKMT2 (NM_001825) Human Over-expression Lysate

Sign In for Pricing
View Details