Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P67165

Expression Region

1-202

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XbaI, 800U
RV1364 800 U

XbaI, 800U

Sign In for Pricing
View Details
SYT14P1 Human Gene Knockout Kit (CRISPR)
KN417762 1 Kit

SYT14P1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rpl18a (BC024609) Mouse Tagged ORF Clone
MG201090 10 µg

Rpl18a (BC024609) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human EPC2 activation kit by CRISPRa
GA108761 1 Kit

Human EPC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SLCO1B3 activation kit by CRISPRa
GA109157 1 Kit

Human SLCO1B3 activation kit by CRISPRa

Sign In for Pricing
View Details
EIF2AK1 Antibody
8C15698-AAT 50 µg

EIF2AK1 Antibody

Sign In for Pricing
View Details