Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P67165

Expression Region

1-202

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTPN22 activation kit by CRISPRa
GA108794 1 Kit

Human PTPN22 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Cat IgG,  10nm
GAF-421-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Cat IgG, 10nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS713612 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
ANKRD24 Human Gene Knockout Kit (CRISPR)
KN423342 1 Kit

ANKRD24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His)
PKSM041436-01 10 µg

Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His)
PKSM041436-02 50 µg

Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-6His)

Sign In for Pricing
View Details