Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P67164

Expression Region

1-202

Origin

Staphylococcus aureus (strain N315)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBAS Antibody (Center)
MBS9204865-01 0.08 mL

GBAS Antibody (Center)

Sign In for Pricing
View Details
GBAS Antibody (Center)
MBS9204865-02 0.4 mL

GBAS Antibody (Center)

Sign In for Pricing
View Details
GBAS Antibody (Center)
MBS9204865-03 5x 0.4 mL

GBAS Antibody (Center)

Sign In for Pricing
View Details
SCNM1 Polyclonal Antibody, Biotin Conjugated
A60799-100 100 µL

SCNM1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TRNT1 Lentiviral Activation Particles (h2)
sc-405194-LAC-2 200 µL

TRNT1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
MAP4K4 Protein Vector (Mouse) (pPM-C-HA)
28043025 500 ng

MAP4K4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details