Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A7X211

Expression Region

1-202

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boldine
TRC-B675170-2.5G 2.5 g

Boldine

Sign In for Pricing
View Details
NXF2B (NM_001099686) Human Over-expression Lysate
LY420497 100 µg

NXF2B (NM_001099686) Human Over-expression Lysate

Sign In for Pricing
View Details
Vanadium(V) Oxide
TRC-V965360-10G 10 g

Vanadium(V) Oxide

Sign In for Pricing
View Details
CULlin 1 (CUL1) Human Gene Knockout Kit (CRISPR)
KN224650LP 1 Kit

CULlin 1 (CUL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASAH2 Polyclonal Antibody
E-AB-14747-01 20 µL

ASAH2 Polyclonal Antibody

Sign In for Pricing
View Details
ASAH2 Polyclonal Antibody
E-AB-14747-02 60 µL

ASAH2 Polyclonal Antibody

Sign In for Pricing
View Details