Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A7X211

Expression Region

1-202

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXJ1 Antibody
8C11446-AAT 50 µg

FOXJ1 Antibody

Sign In for Pricing
View Details
GIT1 Rabbit Polyclonal Antibody
TA376574 100 µL

GIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLAUR (NM_002659) Human Over-expression Lysate
LC400943 20 µg

PLAUR (NM_002659) Human Over-expression Lysate

Sign In for Pricing
View Details
Lucatumumab Biosimilar - Research Grade
ICH5129-20mg 20 mg

Lucatumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)
KN400872 1 Kit

GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4930579G24Rik Mouse Gene Knockout Kit (CRISPR)
KN500408 1 Kit

4930579G24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details