Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A7X211

Expression Region

1-202

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NucView® 488 Caspase-3 Substrate, 1mM in DMSO
#10402 1x 100 µL

NucView® 488 Caspase-3 Substrate, 1mM in DMSO

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2205
BCLT-2205 1 Unit

Low Temperature Circulator BCLT-2205

Sign In for Pricing
View Details
ZNF562 Polyclonal Antibody
E-AB-66365-01 60 µL

ZNF562 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF562 Polyclonal Antibody
E-AB-66365-02 120 µL

ZNF562 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF562 Polyclonal Antibody
E-AB-66365-03 200 µL

ZNF562 Polyclonal Antibody

Sign In for Pricing
View Details
Human ADA (Adenosine Deaminase) CLIA Kit
E-CL-H0218-01 24 Tests

Human ADA (Adenosine Deaminase) CLIA Kit

Sign In for Pricing
View Details