Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A8FKE6

Expression Region

1-202

Origin

Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIFNYDLEIHTHAPVFIIAF IIVYKHLPNIKRLIFKEECKVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A RAM
HA16020023.100G 100 g

Polystyrene A RAM

Sign In for Pricing
View Details
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2698), 0.2mg/mL
BNUB2698-500 1x 500 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2698), 0.2mg/mL

Sign In for Pricing
View Details
Fructose Fluorometric Assay Kit
E-BC-F080 96 T (40 samples)

Fructose Fluorometric Assay Kit

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL
BNC400639-500 1x 500 µL

CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RDR-CBX3-Hu-01 96 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RDR-CBX3-Hu-02 48 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details