Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus Na (+) -translocating NADH-quinone reductase subunit E (nqrE)

This Recombinant Psychrobacter arcticus Na (+) -translocating NADH-quinone reductase subunit E (nqrE) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Na (+) -translocating NADH-quinone reductase subunit E, Na (+) -NQR subunit E, Na (+) -translocating NQR subunit E, EC= 1.6.5.-, NQR complex subunit E, NQR-1 subunit E

UniProt

Q4FPV3

Expression Region

1-202

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLF QFILKDGALAWAGFPDIDLSFLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLI TVNCAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITALAGIREKLKYSDIPAPLRGL GITFITVGLMSLGFMSFGGMSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF740 conjugate, 0.1mg/mL
BNC741077-100 1x 100 µL

Cytokeratin, LMW (KRTL/1077), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (13C4), CF740 conjugate, 0.1mg/mL
BNC740147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/155), CF740 conjugate, 0.1mg/mL
BNC740155-100 1x 100 µL

CD19 (CVID3/155), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details