Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q5HG66

Expression Region

1-202

Origin

Staphylococcus aureus (strain COL)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPR2 (NM_001002001) Human Over-expression Lysate
LC424315 20 µg

GMPR2 (NM_001002001) Human Over-expression Lysate

Sign In for Pricing
View Details
Water Chiller BCHI-311
BCHI-311 Each

Water Chiller BCHI-311

Sign In for Pricing
View Details
CDC2L6 (CDK19) Human Gene Knockout Kit (CRISPR)
KN206105 1 Kit

CDC2L6 (CDK19) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(2R)-1-(9H-Purin-6-ylamino)-2-propanol
TRC-P840285-10MG 10 mg

(2R)-1-(9H-Purin-6-ylamino)-2-propanol

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Hydroxy PEG
1210000-0.1G 1 g

Ɑ-Methoxy-ω-Hydroxy PEG

Sign In for Pricing
View Details
PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)
KN417570 1 Kit

PTP kappa (PTPRK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details