Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000 (PYRAB02000)

This Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000 (PYRAB02000) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

UPF0056 membrane protein PYRAB02000

UniProt

Q9V274

Expression Region

1-202

Origin

Pyrococcus abyssi (strain GE5 / Orsay)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQEILSSALLMLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANIIGFLLLLIFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALESGGMVTIKKEKNILALAAVPVATPLIAGP AAITAAITLTAEYGIVVSVTATFIAIVITAVLMLLSLYLMRGINKTALSVTIRIIGLFIM AIGAQMMISGAGGIVLSILKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details