Recombinant Pseudomonas putida Sulfoxide reductase heme-binding subunit YedZ (yedZ)
This Recombinant Pseudomonas putida Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-203.
Product Specifications
Product Name Alternative
Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ
UniProt
A5W949
Expression Region
1-203
Origin
Pseudomonas putida (strain F1 / ATCC 700007)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRYPWFRLAIFVVGCLFPVWWLYEAAMNLLGPDPGKIMMDRLGLGALTFLLVTLSMTPLQ KLTGWSGWIVVRRQLGLWVFAYIVLHILAYLFFILGLDWGQLAVELRKRPYIIVGALGFL GLLALAVTSNRYSQRRLGARWRKLHRLVYAVLGLGLLHFLWIVRSDLREWAIYAFIGAVL MVLRIPAVARALPRVARKQGRAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882479-100 1x 100 µL
CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881224-500 1x 500 µL
HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551619-100 1x 100 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471782-100 1x 100 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details