Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A9BBV0

Expression Region

1-206

Origin

Prochlorococcus marinus (strain MIT 9211)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTKIFLAFLCIGVSYSLGSFPSGFIAGKWLKGIDLRKVGSGSTGATNVLRHVGKKAAL IVFLIDVSKGIGSILIAKSLFLSPSFHVICGIAALSGHIWPIWLNWKGGKAVATGLGVFL GISWQVGLASLGIFMAVLSSSKIVSLSSISAAISLPILMFLSLQEASFLNAYIIASFAAM IMVLWRHRANLKRLLNGDEPRIGKIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxazole Blue Homodimer, 1 mM in DMSO
#40093 1x 100 µL

Oxazole Blue Homodimer, 1 mM in DMSO

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561665 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
ZNF197 (N-term) Rabbit Polyclonal Antibody
AP54673PU-N 400 µL

ZNF197 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fluo-8L™, AM
21097-AAT 10x 50 µg

Fluo-8L™, AM

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells,  20nm
GM-25-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells, 20nm

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-100 1x 100 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details