Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

A9BBV0

Expression Region

1-206

Origin

Prochlorococcus marinus (strain MIT 9211)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTKIFLAFLCIGVSYSLGSFPSGFIAGKWLKGIDLRKVGSGSTGATNVLRHVGKKAAL IVFLIDVSKGIGSILIAKSLFLSPSFHVICGIAALSGHIWPIWLNWKGGKAVATGLGVFL GISWQVGLASLGIFMAVLSSSKIVSLSSISAAISLPILMFLSLQEASFLNAYIIASFAAM IMVLWRHRANLKRLLNGDEPRIGKIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-6 Monoclonal Antibody
AN200102P-01 20 µL

IL-6 Monoclonal Antibody

Sign In for Pricing
View Details
IL-6 Monoclonal Antibody
AN200102P-02 100 µL

IL-6 Monoclonal Antibody

Sign In for Pricing
View Details
KCNK2 Rabbit Polyclonal Antibody
ER1902-06 100 µL

KCNK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPY2 (BPY2C) (NM_001002761) Human Over-expression Lysate
LC424154 20 µg

BPY2 (BPY2C) (NM_001002761) Human Over-expression Lysate

Sign In for Pricing
View Details
Rdx Mouse Gene Knockout Kit (CRISPR)
KN514636 1 Kit

Rdx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559532 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details